Matcha
HavocAI logo

Frontend Engineer

HavocAI

Apply

Affordable, scalable autonomous maritime systems for defense and commerce.

$97.2M total funding raised· Backed by IQT, B Capital, Trousdale Ventures, Scout Ventures
$125k - $150kFULL TIMERemote · US168 employeesPosted Jul 8
reactjavascripttypescriptrestgraphqlfrontend architecturestate managementapi integrationmapboxleafletdeck.glwebgljestcypressdata visualizationsecurity clearance

Remote startup roles in your inbox

Matcha reads all job descriptions to surface the handful that actually matter in a zero noise email. Simple by design.

Describe your next role, be picky

About Us:

Havoc is a leader in all-domain collaborative autonomy. Its software-defined hardware approach powers military and commercial-grade autonomous systems across sea, air, and land to sense, decide, and act together in complex and contested environments. Havoc connects assets, enabling them to share information, adapt in real time, and continue operating even when communications are disrupted or denied. Havoc optimizes mission performance and minimizes human risk.

Havoc was founded in 2024 and headquartered in Providence, Rhode Island. Learn more at Havoc: All-Domain Collaborative Autonomy .

About the Role

We are seeking a Frontend Engineer to help build and scale the user interfaces that power our platform.

In this role, you will develop data-driven web applications, including map-based and visualization-heavy interfaces. You will work closely with backend, platform, product, and design teams to deliver reliable frontend systems that support real-time data, complex workflows, and operational decision-making.

This role is ideal for someone who has strong frontend fundamentals, enjoys building practical user experiences, and is excited to contribute to systems that operate in real-world, mission-critical environments.

Key Responsibilities

Frontend Systems Development

  • Develop performant user interfaces using React

  • Build and maintain UI components for data-rich applications

  • Support interfaces that handle real-time data, operational workflows, and mission-critical use cases

  • Deliver intuitive, reliable user experiences for complex technical systems

Data Integration & Performance

  • Integrate frontend applications with backend services using REST, GraphQL, or similar APIs

  • Support rendering performance improvements for large datasets and real-time updates

  • Help ensure responsive, reliable performance across devices, browsers, and operating environments

  • Debug frontend issues and contribute to ongoing performance improvements

Architecture & Maintainability

  • Contribute to frontend architecture, including state management, data flow, and application structure

  • Build and maintain reusable components and UI patterns

  • Write clean, testable, maintainable, and well-documented code

  • Follow established engineering standards and contribute improvements over time

Cross-Functional Collaboration

  • Partner with backend, platform, product, and design teams to deliver end-to-end features

  • Collaborate with UX/design to implement high-quality, usable interfaces

  • Participate in code reviews, design discussions, technical planning, and roadmap execution

  • Communicate progress, tradeoffs, and technical considerations clearly

Qualifications

  • 3–5+ years of experience in frontend engineering or related software engineering roles

  • Strong experience with React and modern JavaScript or TypeScript

  • Experience building data-driven web applications

  • Experience working with APIs and asynchronous data flows

  • Solid understanding of frontend architecture, state management, and performance considerations

  • Experience with modern frontend tooling, build systems, and development workflows

  • Ability to build reliable interfaces for complex workflows and data-rich applications

  • Strong problem-solving skills and ability to work in a fast-moving environment

  • Strong written and verbal communication skills

  • U.S. citizenship and ability to obtain and maintain a security clearance

Preferred Skills

  • Experience building map-based or geospatial applications using tools such as Mapbox, Leaflet, or Deck.gl

  • Familiarity with WebGL or advanced visualization frameworks

  • Experience with automated testing frameworks such as Jest, Cypress, or similar tools

  • Understanding of design systems and reusable component architecture

  • Experience with real-time systems, data streaming applications, or operational dashboards

  • Experience supporting mission-critical, real-world deployed systems

  • Experience working in small, fast-moving engineering teams or high-growth technology companies

  • Active or prior security clearance

What Success Looks Like

Within 12 months, success in this role looks like consistent delivery of reliable, performant frontend features that support real-world operations. You will have contributed to intuitive interfaces for complex data and workflows while improving frontend usability, responsiveness, and maintainability.

You will also have built strong working relationships across engineering, product, and design teams while contributing reusable UI components and patterns across the platform.

Benefits:
  • 100% Employer paid Health, Dental and Vision Insurance for you and your families

  • Life Insurance (Employer Paid)

  • Ability to participate in the companies 401k program (Matching)

  • Unlimited PTO policy with an enforced 2 week minimum

  • Equity Package

  • Work / Home Office Stipend

  • Global Entry

  • 16 Week Paid Parental Leave

  • Monthly Health and Wellness Stipend


Our Values:
  • Innovation: We are driven to break new ground. Every day presents an opportunity to challenge the status quo, think boldly, and deliver advanced solutions that transform the future of defense technology.

  • Integrity: We hold ourselves to the highest ethical standards, ensuring transparency, accountability, and trust in all our actions and partnerships.

  • Mission-Driven: We are focused on achieving impactful outcomes that align with our core mission—protecting lives through innovation.

  • Forward-Leaning: We continuously seek out new opportunities and remain at the forefront of technological advancements. We embrace change and anticipate the challenges of tomorrow with confidence and creativity.

  • Ownership of All Tasks: At HavocAI, no problem is too complex or too trivial. We believe that greatness comes from tackling the hardest challenges, but also in handling the smallest, sometimes thankless, tasks with the same level of commitment and care.

  • Servant Leadership: We lead by serving others, whether it’s supporting our employees, partners, or the broader community. Empowering those around us is key to achieving long-term success and making a lasting impact.

HavocAI is an Equal Opportunity Employer and is committed to creating an inclusive and diverse workplace. We welcome applicants from all backgrounds and do not discriminate based on race, color, religion, gender, sexual orientation, age, national origin, disability, veteran status, or any other legally protected status.